| Desktop | 80/100 | ✔ |
| Mobile | 42/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 49 KB | ✔ |
| Compression | 10 KB (-78.8%) | ✔ |
| Text/Html Ratio | 2250 / 50382 (bytes) = 4.47% | ❗ |
| Load Time | 1.53 second | ✘ |
| Mobile Ready | 99/100 | ✔ |
| In-Page Links | 31 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 5 / 7 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| speaking | 10 | ✘ | ✘ | ✘ |
| tips | 7 | ✘ | ✔ | ✔ |
| consulting | 6 | ✘ | ✘ | ✘ |
| legal | 5 | ✔ | ✔ | ✔ |
| wednesday | 4 | ✔ | ✔ | ✔ |
| introduction | 4 | ✘ | ✘ | ✘ |
| brand | 4 | ✘ | ✘ | ✘ |
| ambassador | 4 | ✘ | ✘ | ✘ |
| podcast | 4 | ✘ | ✘ | ✘ |
| live | 4 | ✘ | ✔ | ✘ |
| mastermind | 3 | ✘ | ✘ | ✔ |
| newsroom | 2 | ✘ | ✘ | ✘ |
| about | 2 | ✘ | ✘ | ✘ |
| mitch | 2 | ✘ | ✔ | ✘ |
| i’ll | 2 | ✘ | ✘ | ✘ |
|
With 1.53 seconds in page load, 49 KB of page size and all other reports below, the wednesdaynightlegalmarketing.com has a SEO score of 63 out of 100 |
| Title | WEDNESDAY NIGHT LEGAL MARKETING – Streaming.Lawyer |
| Description | FREE Marketing Tips For Lawyers! Every Wednesday night I go live on Facebook at MitchJackson.live and share FREE legal marketing tips, approaches and guest experts, to help build your law practice. I hit the "go live" button at 5 pm PT (8 pm ET) so stop by, say hi, and enjoy the content! Each… |
| Keyword |
| Age | 0 Years, 2 Days |
| Created | 10th-Apr-2020 |
| Updated | 10th-Apr-2020 |
| Expiry | 10th-Apr-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
No match for "w" in the registrar database. |
| Server IP | 184.168.131.241 |
| Server Location | United States |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| wednesdaynightlegalmarketing.net | Available |
| wednesdaynightlegalmarketing.org | Available |
| wednesdaynightlegalmarketing.biz | Already Registered |
| wednesdaynightlegalmarketing.io | Already Registered |
| wednesdaynightlegalmarketing.info | Available |
| Domains (TLD) | Status |
|---|---|
| qednesdaynightlegalmarketing.com | Available |
| aednesdaynightlegalmarketing.com | Available |
| sednesdaynightlegalmarketing.com | Available |
| dednesdaynightlegalmarketing.com | Available |
| eednesdaynightlegalmarketing.com | Available |
| Canterandcie.com |
| Privilege.fyi |
| Pamelaw-personaltraining.com |
| Pelisred.net |
| Brandatbanat.com |
| Screwthisiquit.com |
| Thatsmileco.com |
| Secondorderstudio.com |
| Goddessvibesphilly.biz |
| Thecannabisinvestor.ca |